DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CLEC12B

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001123470.1 Gene:CLEC12B / 387837 HGNCID:31966 Length:276 Species:Homo sapiens


Alignment Length:218 Identity:43/218 - (19%)
Similarity:73/218 - (33%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 QEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQ----YYGNIFHRDPSENEVDNDCP 225
            |::::....|..:...|:.:|:|   ::..:.||...|...    ....|.|..      |:.|.
Human    86 QQQQDNLSQQLGNSNNLSMEEEF---LKSQISSVLKRQEQMAIKLCQELIIHTS------DHRCN 141

  Fly   226 NCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHI 290
            .|....|:..|..           ||.....:..|..:.:.|......|..|.|.||.|.|....
Human   142 PCPKMWQWYQNSC-----------YYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQP 195

  Fly   291 RDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKG 355
            .   |....||:         ...|.::||...:.:.:...|:.|..:..::.|       ..||
Human   196 L---LMFSFFWL---------GLSWDSSGRSWFWEDGSVPSPSLFSTKELDQIN-------GSKG 241

  Fly   356 LKWND------SPCSFETYFVCE 372
            ..:..      |.||.|.:::||
Human   242 CAYFQKGNIYISRCSAEIFWICE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 28/130 (22%)
CLEC12BNP_001123470.1 ITIM motif 5..10
CLECT_NK_receptors_like 143..265 CDD:153063 31/152 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.