Sequence 1: | NP_612091.1 | Gene: | tfc / 38141 | FlyBaseID: | FBgn0035199 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123470.1 | Gene: | CLEC12B / 387837 | HGNCID: | 31966 | Length: | 276 | Species: | Homo sapiens |
Alignment Length: | 218 | Identity: | 43/218 - (19%) |
---|---|---|---|
Similarity: | 73/218 - (33%) | Gaps: | 49/218 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 165 QEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQ----YYGNIFHRDPSENEVDNDCP 225
Fly 226 NCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHI 290
Fly 291 RDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKG 355
Fly 356 LKWND------SPCSFETYFVCE 372 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tfc | NP_612091.1 | CLECT | 249..373 | CDD:153057 | 28/130 (22%) |
CLEC12B | NP_001123470.1 | ITIM motif | 5..10 | ||
CLECT_NK_receptors_like | 143..265 | CDD:153063 | 31/152 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |