DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CG14499

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001261072.3 Gene:CG14499 / 37086 FlyBaseID:FBgn0034317 Length:188 Species:Drosophila melanogaster


Alignment Length:80 Identity:18/80 - (22%)
Similarity:35/80 - (43%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 IFFKANWFK-ATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMA 317
            :.|..:|.. ..::|:.....|.|.|::.|...:.:.:..........|.||..|....:::|.:
  Fly    43 LLFDNSWKNFLDRHCQSLNAGLLSFSNKMEFTAINEWLTTVVPQSPELWTSGNKLGGSEDYYWQS 107

  Fly   318 TGRPITFTNWNAGEP 332
            ||:...:..|.||:|
  Fly   108 TGKKAFYLPWQAGQP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 18/80 (23%)
CG14499NP_001261072.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.