DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Cd209

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001102319.1 Gene:Cd209 / 363856 RGDID:1561104 Length:237 Species:Rattus norvegicus


Alignment Length:261 Identity:57/261 - (21%)
Similarity:92/261 - (35%) Gaps:94/261 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ADDQERDQQPLANQEDFDYDVQESLQSV------------------------------------- 198
            ::..|.:.|.|.|.||.:|.:..|..|:                                     
  Rat     2 SESMESNTQQLDNPEDEEYLMSGSRYSIISSRLRTKFGIKSLAEYTKQSHNPLVLPLLSFLFLAG 66

  Fly   199 -------------ESEQHDQYYGNIFHRDPSENEV-DNDCPNCVDESQYTPNKWTMPLLKLGEKR 249
                         .||..|:.|..:..   .:.|| |..|..|       |..||          
  Rat    67 LLLIILVLVSKVPSSEVQDKIYQELMQ---LKTEVHDGLCQPC-------PRDWT---------- 111

  Fly   250 YYLG--IFF---KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLAD 309
            ::.|  .||   :.||..:...|:..|..|..:.:.||...|::..:..|    ..|:..:|:.:
  Rat   112 FFNGSCYFFSKSQRNWHNSITACKELGAQLVIVETDEEQTFLQQTSKTRG----PTWMGLSDMHN 172

  Fly   310 EGNFFWMATGRPI--TFTN-WNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 371
            |..:.|: .|.|:  :|.. ||.|||||.     .:|:|.| ::.||    |||..|....:::|
  Rat   173 EATWHWV-DGSPLSPSFAQYWNRGEPNNV-----GDEDCAE-FSGDG----WNDLRCDTRIFWIC 226

  Fly   372 E 372
            :
  Rat   227 K 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/132 (27%)
Cd209NP_001102319.1 CLECT_DC-SIGN_like 106..228 CDD:153060 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.