DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Klrb1a

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001010964.1 Gene:Klrb1a / 362443 RGDID:1586149 Length:223 Species:Rattus norvegicus


Alignment Length:130 Identity:23/130 - (17%)
Similarity:41/130 - (31%) Gaps:50/130 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 WFKATQYCRYHGMHLASISSQEE---NDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRP 321
            |.::...|...|..|..:..|||   ...|.|.|                    .:.||:.....
  Rat   115 WKESLADCGGKGATLLLVQDQEELRFLRNLTKRI--------------------SSSFWIGLSYT 159

  Fly   322 ITFTNWNAGEPNNFRYENG--------------EEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            ::..||        ::.||              |:::|..: ::|    |.....|..:..:||:
  Rat   160 LSDENW--------KWINGSTLNSDVLSITGDTEKDSCASV-SQD----KVLSESCDSDNIWVCQ 211

  Fly   373  372
              Rat   212  211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 23/130 (18%)
Klrb1aNP_001010964.1 LCK-binding motif 32..35
CLECT_NK_receptors_like 94..212 CDD:153063 23/130 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.