DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4d

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001003707.1 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:162 Identity:42/162 - (25%)
Similarity:69/162 - (42%) Gaps:34/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 CV-DESQ--YTPNKWTMPLLKLGEKRYYLGIFFKAN----WFKATQYCRYHGMHLASISSQEEND 284
            |: :|.|  .|...||  ...:..:.:....:|..|    |.::.:.|.....||.:|:::.|.|
  Rat    65 CILEEPQPGATGGTWT--CCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQD 127

  Fly   285 ----RLEKHIRDF-GLGHEHFWISGTDLADEGNFFWM--ATGRP-ITFTNWNAGEPNNFRYENGE 341
                .|::....| ||.:|..         ||.:.|:  ....| :.|  |..|||     ::..
  Rat   128 FVTQLLDEQFSYFLGLSYEKV---------EGQWQWVDKTPFNPNVVF--WKVGEP-----KDSM 176

  Fly   342 EENCLELWNRDGKGLKWNDSPCSFETYFVCEV 373
            ||:|:.|.....|.: |||.||.||...:|::
  Rat   177 EEDCVVLVYDQDKWV-WNDFPCHFEMGRICKL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/135 (27%)
Clec4dNP_001003707.1 CLECT_DC-SIGN_like 82..206 CDD:153060 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.