DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4a3

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001005891.1 Gene:Clec4a3 / 362431 RGDID:1359528 Length:237 Species:Rattus norvegicus


Alignment Length:175 Identity:47/175 - (26%)
Similarity:72/175 - (41%) Gaps:58/175 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ENEVDNDCP--------NCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMH 273
            |::|.:.||        ||     |.|:..::                 .:|.::.:.|...|.|
  Rat   100 EDKVWSCCPKDWKPFDSNC-----YFPSTDSV-----------------ESWMESEEKCSGIGAH 142

  Fly   274 LASISSQEEND----RLEKHIRDF-GL---GHEHF-WISGTDLADEGNFFWMATGRPITFTNWNA 329
            |..|.||||.|    .|:.|...| ||   ||..: |:..|..  .||         .||  |:.
  Rat   143 LVVIHSQEEQDFLPRILDTHAAYFIGLSDPGHRQWQWVDQTPY--NGN---------ATF--WHE 194

  Fly   330 GEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
            |||::      :.|.|:.:.:.:..|..|:||.||.:...||:|:
  Rat   195 GEPSS------DNEQCVIINHHENTGWGWSDSSCSDKQKLVCQVK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/132 (29%)
Clec4a3NP_001005891.1 CLECT_DC-SIGN_like 107..231 CDD:153060 43/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344293
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.