DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CG11211

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:137 Identity:41/137 - (29%)
Similarity:70/137 - (51%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PLLKLGEKRYYLGI--FFKANWFKATQYCRYHGMHLASISSQEENDRLEKHI--RDFGLGHEHFW 301
            |||:...   |..:  |.:.||.:|...|...|..||::.::|::..:..::  ::...|:..||
  Fly    34 PLLQCNA---YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFW 95

  Fly   302 ISGTDLADEGNFF-WMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSF 365
            :..|:|.|...|: ||:||.|:|:..|:..||.:.|  .|::. ||.|    |....|:..||..
  Fly    96 LGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDR--TGQDA-CLVL----GTDNLWHSEPCQR 153

  Fly   366 ETYFVCE 372
            :..|:||
  Fly   154 KHNFICE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/129 (29%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 34/117 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7663
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.