DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and bcan

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001077282.1 Gene:bcan / 334113 ZFINID:ZDB-GENE-030131-6045 Length:1295 Species:Danio rerio


Alignment Length:403 Identity:77/403 - (19%)
Similarity:138/403 - (34%) Gaps:147/403 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DSGHNSPVTTIPVAE-PISQVPHGFQLGQNNHISSS-----SNISRSGGGNGRDKRGAQLDPSEI 75
            |...|..:|..|..: .::.:|||.|......:.:|     :::..||      :.....|....
Zfish   888 DDEDNQAITVEPTTDLEVTFLPHGTQTSIWQSVVTSPGELNADVEFSG------EAALTTDDMRA 946

  Fly    76 ARQNQITQQIFANYLERRLFPNRTANQKIPTIADILPKPKPSPRPRPRGFAASDGGNFKRSGGGA 140
            ..:::.|....:...|..|.|:.|.:.                                      
Zfish   947 LEESESTNAPISEQTEETLKPSSTTDH-------------------------------------- 973

  Fly   141 QRNRLAAAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQS----VESE 201
                                 .:..:::.:.||.|...:.:...|:.:.||:.:.:|    |...
Zfish   974 ---------------------NDADDDDNDNDDDELITKAITGNEEDENDVKTTHESFIIPVRPT 1017

  Fly   202 Q----HDQYYGNIFHRDPSENEVDNDCPN---CVD--------------------ESQYTPNKWT 239
            |    ...|.        |:..::|.|.|   |||                    :.::....| 
Zfish  1018 QRVLIRTSYI--------SDACLENPCKNGGTCVDSGGDQRCLCLPTYGGDFCETDLEHCEPGW- 1073

  Fly   240 MPLLKLGEKRYYLGIFFK-----ANWFKATQYCRYHGMHLASISSQEE----NDRLEKHIRDFGL 295
                   ||  :.|..:|     ..|..|.|:||..|.||.|:.|.||    ||:.         
Zfish  1074 -------EK--FQGFCYKHFAKRQKWEVAEQHCRMCGGHLVSVMSPEEQLFINDKY--------- 1120

  Fly   296 GHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLEL-WNRDGKGLKWN 359
             .|:.|....|...||:|.| :.|.|:.:.||..|:|::: :.:||:  |:.: |..||   :|:
Zfish  1121 -REYQWTGLNDKTIEGDFRW-SDGNPLLYQNWYRGQPDSY-FLSGED--CVVMVWYDDG---RWS 1177

  Fly   360 DSPCSFETYFVCE 372
            |.||:::..:.|:
Zfish  1178 DIPCNYQLSYTCK 1190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 40/134 (30%)
bcanNP_001077282.1 IG_like 38..151 CDD:214653
Ig 45..155 CDD:299845
Link_domain_CSPGs_modules_1_3 154..248 CDD:239594
Link_domain_CSPGs_modules_2_4 255..350 CDD:239597
EGF_CA 1029..1063 CDD:238011 6/33 (18%)
CLECT 1069..1192 CDD:295302 43/149 (29%)
CCP 1197..1253 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8750
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.