DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CG15358

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster


Alignment Length:190 Identity:55/190 - (28%)
Similarity:83/190 - (43%) Gaps:36/190 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 QEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKL-GE 247
            ||.|..|:...|..:||:|      ....|..|:.:                .|...|..:| |.
  Fly    91 QEGFPKDIVARLDRLESQQ------AALLRILSKFD----------------RKIVAPKFELIGS 133

  Fly   248 KRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGN 312
            :.:|:....:.||..|...||..|..||:|.|.||...|...:..    ..|:|:..|||..||:
  Fly   134 RFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNK----ERHYWLDITDLEKEGD 194

  Fly   313 FFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            |...|:|:...|..|.||:||||    ...::|::|.:    ||.: |:.|...:||:|:
  Fly   195 FRISASGKRPNFLKWRAGQPNNF----SGNQHCVDLLD----GLMY-DNKCESLSYFICQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/124 (33%)
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.