DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CG12111

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:168 Identity:60/168 - (35%)
Similarity:90/168 - (53%) Gaps:23/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 NIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMH 273
            |||..  ...||.|..|:.:|         |.|.:::|:..||:....|.|||:|...||....|
  Fly    26 NIFTN--YRTEVYNGIPSEID---------TTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAH 79

  Fly   274 LASISSQEENDRLEKHIRDFGL-GHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGE--PNNF 335
            ||||..:.|.:.|.|:::..|. .:::|||||.||..||.|:||:.|||:|:..||..:  |:|:
  Fly    80 LASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNY 144

  Fly   336 RYENGEEENCLELW-NRDGKGLKWNDSPCSFETYFVCE 372
                |..|||:.:: .|:    ..||:.|..:..:|||
  Fly   145 ----GGNENCVHMFATRE----MINDANCKIQMLYVCE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 49/128 (38%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 47/126 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8850
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 1 1.000 - - otm25696
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.