DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CD209

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:244 Identity:64/244 - (26%)
Similarity:97/244 - (39%) Gaps:55/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RLAAAA------SKRQSGYNR-KRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESE 201
            ||.||.      ||:|..|.. .||:....|..|...|:...|.|...:....::.|     :|:
Human   175 RLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPE-----KSK 234

  Fly   202 QHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLG-IFF----KANWF 261
            |.:.|.    .....:..|:..|..|       |.:||          ::.| .:|    :.||.
Human   235 QQEIYQ----ELTQLKAAVERLCHPC-------PWEWT----------FFQGNCYFMSNSQRNWH 278

  Fly   262 KATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPI--TF 324
            .:...|:..|..|..|.|.||.:.|:   ......:...|:..:||..||.:.|: .|.|:  :|
Human   279 DSITACKEVGAQLVVIKSAEEQNFLQ---LQSSRSNRFTWMGLSDLNQEGTWQWV-DGSPLLPSF 339

  Fly   325 TN-WNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            .. ||.|||||.     .||:|.|.   .|.|  |||..|:...:::|:
Human   340 KQYWNRGEPNNV-----GEEDCAEF---SGNG--WNDDKCNLAKFWICK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/132 (30%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
PilO 38..>184 CDD:294757 4/8 (50%)
neck domain 60..249 19/82 (23%)
CLECT_DC-SIGN_like 256..379 CDD:153060 43/154 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.