DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and RGD1564571

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:RGD1564571 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:175 Identity:49/175 - (28%)
Similarity:79/175 - (45%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 SEQHDQYYGNIFHR-DPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKA 263
            |::|||....:..: |..:..:|:.|..|       |..||     ..:...|....|:..|.::
  Rat    52 SQEHDQQKQRMHQKLDQLKTGLDHLCRPC-------PWDWT-----FFQGNCYFFSTFQKKWKES 104

  Fly   264 TQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTN-W 327
            ...|:..|..|..|.|.||...|::..:..|    :.||..:|..:|..:.|: .|.|:.:.| |
  Rat   105 VIACKDMGAQLVVIKSYEEQSFLQRTSKMKG----NTWIGLSDSQEEDQWLWV-DGSPLQWRNYW 164

  Fly   328 NAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            :||||||.     .:|:|:|.     ....|||..||||.:::|:
  Rat   165 SAGEPNNL-----YDEDCVEF-----SSYGWNDISCSFEKFWICK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/125 (30%)
RGD1564571XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 42/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.