DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Asgr2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_058885.1 Gene:Asgr2 / 29403 RGDID:2161 Length:301 Species:Rattus norvegicus


Alignment Length:143 Identity:45/143 - (31%)
Similarity:69/143 - (48%) Gaps:24/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PNKWTMPLLKLGEKRYYL---GIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLG 296
            |..|    ::.|...|:.   |:    .|.:|.|||:....||..|:|:||.:.:.||     .|
  Rat   171 PVNW----VEFGGSCYWFSRDGL----TWAEADQYCQMENAHLLVINSREEQEFVVKH-----RG 222

  Fly   297 HEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFR-YENGEEENCLELWNRDGKGLKWN 359
            ..|.||..||  .:|::.|: .|.....|.||...:|:|:: :|.|..|:|.|:.: ||   .||
  Rat   223 AFHIWIGLTD--KDGSWKWVDGTEYRSNFKNWAFTQPDNWQGHEEGGSEDCAEILS-DG---LWN 281

  Fly   360 DSPCSFETYFVCE 372
            |:.|.....:.||
  Rat   282 DNFCQQVNRWACE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 42/129 (33%)
Asgr2NP_058885.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Lectin_N 29..162 CDD:397859
CLECT_DC-SIGN_like 170..295 CDD:153060 45/143 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.