DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec11a

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001012477.1 Gene:Clec11a / 29313 RGDID:3627 Length:328 Species:Rattus norvegicus


Alignment Length:371 Identity:72/371 - (19%)
Similarity:122/371 - (32%) Gaps:91/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPH--GFQLGQNNHISSSSNISRSGGGNGRDKRGAQLD--------PSEIARQNQITQQIFANYL 90
            |||  .|..|...|......:........||:....|.        |:.:..::.:.:......:
  Rat    12 VPHLLSFGHGARGHGKEWEGVWGGALEEERDRESLMLKNLQEALGLPTGVGNKDNLAENSEGKEV 76

  Fly    91 -ERRLFPNRTANQKIPTIADILPKPKPSPRPRPRGFAASDGGNFKRSGGGAQRNRLAAAASKRQS 154
             |..........::..|.....|.|.|||.|..........|            |||:.    .:
  Rat    77 WEATETQGEEEEEETTTTPSSSPTPFPSPSPTSEDTVTYILG------------RLASL----DA 125

  Fly   155 GYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQ--HDQYYGNIFHRDPSE 217
            |.::..:|....:....:    ..|.|....|...|.::|:|:::..|  .:|.:|.:       
  Rat   126 GLHQLHIRLHVLDTRVVE----LTQGLRRLRDAASDTRDSVQALKEVQVRSEQEHGRL------- 179

  Fly   218 NEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEE 282
                   ..|:..            |:||.|.:.|...|:.. ..|...|:..|..||..:.:::
  Rat   180 -------EGCLKG------------LRLGHKCFLLSRDFETQ-AAAQARCKARGGSLAQPADRQQ 224

  Fly   283 NDRLEKHIRDFGLGHEHF--WISGTDLADEGNFFWMATGRPITFTNWNAG--------------- 330
            .|.|.:::| ..|...::  |:...|...|| .:....|:.::|..|:..               
  Rat   225 MDALSRYLR-AALAPYNWPVWLGVHDRRSEG-LYLFENGQRVSFFAWHRALSPESGAQPSAASHP 287

  Fly   331 ----EPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
                :||     .|..|||:...:.||   .|.|..|....|||||
  Rat   288 LSPDQPN-----GGILENCVAQASDDG---SWWDHDCERRLYFVCE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/145 (23%)
Clec11aNP_001012477.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..111 9/52 (17%)
CLECT 182..326 CDD:413318 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.