DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Sell

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038946544.1 Gene:Sell / 29259 RGDID:3655 Length:460 Species:Rattus norvegicus


Alignment Length:116 Identity:32/116 - (27%)
Similarity:57/116 - (49%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 NWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPIT 323
            ||..|.::|:::...|.:|.::.|.:.|||.:..   ...::||....:..  .:.|:.|.:.:|
  Rat   107 NWENARKFCKHNYTDLVAIQNKREIEYLEKTLPK---NPTYYWIGIRKIGK--TWTWVGTNKTLT 166

  Fly   324 --FTNWNAGEPNNFRYENGEEENCLELW-NRDGKGLKWNDSPCSFETYFVC 371
              ..||..|||||.:    .:|:|:|:: .|:....||||..|......:|
  Rat   167 KEAENWGTGEPNNKK----SKEDCVEIYIKRERDSGKWNDDACHKRKAALC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 32/116 (28%)
SellXP_038946544.1 CLECT_selectins_like 97..215 CDD:153062 32/116 (28%)
EGF_CA 218..250 CDD:238011
CCP 255..313 CDD:153056
PHA02817 275..>384 CDD:165167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.