DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4m

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038945074.1 Gene:Clec4m / 288378 RGDID:1561466 Length:336 Species:Rattus norvegicus


Alignment Length:210 Identity:56/210 - (26%)
Similarity:83/210 - (39%) Gaps:60/210 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 YDVQ-ESLQSVESEQHDQYYGNIFHRDPS-------------------ENEVDNDCPNCVDESQY 233
            :.|| ||:|...|||..|....:..:.||                   :.|:...|..|      
  Rat   148 FQVQNESMQEKISEQLTQLKAELLSKIPSLQVQDESKQEKIYQQLVQMKTELLRLCRLC------ 206

  Fly   234 TPNKWTMPLLKLGEKRYYLG-IFF----KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDF 293
             |..||          :.|| .:|    :.||..|.:.|:.....|..|:|.||...|:...:..
  Rat   207 -PWDWT----------FLLGNCYFLSKSQRNWNDAVRACKEEKAQLVIINSDEEQTFLQLTSKAK 260

  Fly   294 GLGHEHFWISGTDLADEGNFFWMATGRPIT--FTN-WNAGEPNNFRYENGEEENCLELWNRDGKG 355
            |    ..|:..:||.:|..:.|: .|..::  |.. ||.|||||.     .||:|:|.   .|.|
  Rat   261 G----PTWMGLSDLKNEATWLWV-DGSTLSSRFQKYWNRGEPNNI-----GEEDCVEF---AGDG 312

  Fly   356 LKWNDSPCSFETYFV 370
              ||||.|..:.:::
  Rat   313 --WNDSKCELKKFWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/130 (30%)
Clec4mXP_038945074.1 CLECT_DC-SIGN_like 206..328 CDD:153060 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.