DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CLEC4E

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:127 Identity:37/127 - (29%)
Similarity:58/127 - (45%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 FFKA---NWFKATQYCRYHGMHLASISSQEENDRL---EKHIRDFGLGHEHFWISGTDLADEGNF 313
            ||..   :|..:.:.|...|.||..|:||||.:.|   :..:|:|.:|.       :|...||.:
Human    93 FFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGL-------SDQVVEGQW 150

  Fly   314 FWMATGRPIT--FTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEV 373
            .|: .|.|:|  .:.|:.|||||.    ...|:|..:.:.......|||..|....:.:||:
Human   151 QWV-DGTPLTKSLSFWDVGEPNNI----ATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEM 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/125 (29%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 36/125 (29%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150878
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.