DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Bcan

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038957712.1 Gene:Bcan / 25393 RGDID:2194 Length:890 Species:Rattus norvegicus


Alignment Length:466 Identity:103/466 - (22%)
Similarity:165/466 - (35%) Gaps:142/466 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DSGH-------NSPVT-----TIPVAEPISQVPHGFQLGQNNHISSSSN------ISRSGGGNGR 63
            ||.|       :||.:     .:.|.|.:.::    ||.|....|.|..      |:..|||...
  Rat   354 DSAHPSAFSEASSPASDGLEAIVTVTEKLEEL----QLPQEAVESESRGAIYSIPITEDGGGGSS 414

  Fly    64 DKRGAQLDPSEIARQ--NQITQQIF-----------ANYLERRLFPNRTANQK------------ 103
            ...    ||:|..|.  ...||.:.           |...|.|.....|..::            
  Rat   415 TPE----DPAEAPRTPLESETQSVAPPTGSSEEEGEALEEEERFKDTETPKEEKEQENLWVWPTE 475

  Fly   104 ----IPT-------IADILPKPK--------PSPR-PRPRGFAASD-----GGNFKRSGGGAQRN 143
                :||       ::.:.|..:        |||| ||..|..|..     .|:...:..|| |.
  Rat   476 LSSPLPTGLETEHSLSQVSPPAQAVLQLGASPSPRPPRVHGPPAETLQPPREGSLTSTPDGA-RE 539

  Fly   144 RLAAAASKRQSGYNRKRLREEQEEEEEADDQERDQ---------QPLANQEDFDYDVQESLQSVE 199
            ......|...||..|        |.|||.....:.         .|:..:|......::|.::|.
  Rat   540 VAGETGSPELSGVPR--------ESEEAGSSSLEDGPSLLPATWAPVGTRELETPSEEKSGRTVL 596

  Fly   200 SEQHDQYY----------GNIFHRDPSENEVDNDCPN---CVDESQYTPNKWTMPLLKLGEKRYY 251
            :....|..          |.:.....|.:.:.:.|.|   |::|.:   ....:.|...|.....
  Rat   597 TGTSVQAQPVLPTDSASRGGVAVAPSSGDCIPSPCHNGGTCLEEKE---GFRCLCLPGYGGDLCD 658

  Fly   252 LGIFF------------------KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE 298
            :|:.|                  :.:|.:|...||..|.||.||.:.||.|.:....|      |
  Rat   659 VGLHFCSPGWEAFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYR------E 717

  Fly   299 HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLEL-WNRDGKGLKWNDSP 362
            :.||...|...||:|.| :.|.|:.:.|||.|:|::: :.:|  |||:.: |:..|   :|:|.|
  Rat   718 YQWIGLNDRTIEGDFLW-SDGAPLLYENWNPGQPDSY-FLSG--ENCVVMVWHDQG---QWSDVP 775

  Fly   363 CSFETYFVCEV 373
            |::...:.|::
  Rat   776 CNYHLSYTCKM 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/142 (29%)
BcanXP_038957712.1 Ig 40..158 CDD:416386
Ig strand A' 44..46 CDD:409353
Ig strand B 50..58 CDD:409353
Ig strand C 75..81 CDD:409353
Ig strand C' 86..89 CDD:409353
Ig strand D 107..112 CDD:409353
Ig strand E 118..124 CDD:409353
Ig strand F 132..139 CDD:409353
Ig strand G 149..158 CDD:409353
Link_domain_CSPGs_modules_1_3 156..250 CDD:239594
Link_domain_CSPGs_modules_2_4 257..352 CDD:239597
fibronec_FbpA <369..629 CDD:411474 51/276 (18%)
EGF 626..655 CDD:394967 6/31 (19%)
CLECT 664..787 CDD:413318 39/136 (29%)
CCP 791..848 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9084
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45888
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.