DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Reg3g

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_775120.1 Gene:Reg3g / 24620 RGDID:3256 Length:174 Species:Rattus norvegicus


Alignment Length:142 Identity:38/142 - (26%)
Similarity:53/142 - (37%) Gaps:28/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 GEKRY--YLGIFFKA--NWFKATQYC--RYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISG 304
            |.:.|  |....|..  :||.|...|  |..| ||.|:.|..|...:...|:..|...::.||..
  Rat    43 GSRAYGSYCYALFSVSKSWFDADLACQKRPSG-HLVSVLSGSEASFVSSLIKSSGNSGQNVWIGL 106

  Fly   305 TD--LADE---GNFFWMATGRPITFTNWNAGEPNNFRYENGEE----ENCLELWNRDGKGLKWND 360
            .|  |..|   |.:.|.           ||...|.|.:|....    .:|..|....| .|:|.:
  Rat   107 HDPTLGQEPNRGGWEWS-----------NADVMNYFNWETNPSSVSGSHCGTLTRASG-FLRWRE 159

  Fly   361 SPCSFETYFVCE 372
            :.|..|..:||:
  Rat   160 NNCISELPYVCK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/139 (27%)
Reg3gNP_775120.1 CLECT_REG-1_like 40..172 CDD:153064 38/142 (27%)
EPN. /evidence=ECO:0000250 114..116 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.