DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Klrh1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_631926.1 Gene:Klrh1 / 246043 RGDID:621452 Length:231 Species:Rattus norvegicus


Alignment Length:115 Identity:29/115 - (25%)
Similarity:47/115 - (40%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 RDPSENEVDNDCPNCVDESQYTP----------NKWTMPLLKLGEKRYYLGIFFKANWFKATQYC 267
            :|.::|.|.:  ...||.|...|          .:|    ...|||.||.....| .|.::...|
  Rat    75 KDANKNAVSS--MEVVDPSALPPTTGKGCYKCQGRW----FCCGEKCYYFSEEEK-TWDESEASC 132

  Fly   268 RYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADE-GNFFWM 316
            |..|.|||.|.::||.:.::..:      :..:|:.   |..: |.|.|:
  Rat   133 RLLGSHLAKIDNREEQNFIQSRL------NYSYWVG---LRKKGGQFLWV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 18/69 (26%)
Klrh1NP_631926.1 Ly49 36..118 CDD:285577 12/48 (25%)
CLECT_NK_receptors_like 104..220 CDD:153063 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.