DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Klre1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006506184.1 Gene:Klre1 / 243655 MGIID:2662547 Length:252 Species:Mus musculus


Alignment Length:180 Identity:37/180 - (20%)
Similarity:66/180 - (36%) Gaps:50/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 NIFHRDPS-ENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGM 272
            |.|||..| |.|........:||:..|.:...:...:..:.:         |..|.|       :
Mouse     7 NNFHRKASLEPESQTSDGILMDEAPVTRSTLNVNSQQKSKAK---------NKIKNT-------L 55

  Fly   273 HLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGN----------------FFWMATGRP 321
            :...:||.|:..:.:||::.    |::   :..|::.:||                ...||....
Mouse    56 NSNELSSIEQRKKYQKHLKK----HKN---TAEDISGKGNCSPPWRLLSSVLGAMCLLLMAVAMV 113

  Fly   322 I-TFTNWNAGEPNNFR-YENGEEENCLE--LWNR------DGKGLKWNDS 361
            : |||..::.|.::.. .:.|....|.|  :|.|      ..:.|.|.||
Mouse   114 MTTFTTKSSSERSSSTIQQEGLHHPCPENWVWFRCSCYFFSKEELIWRDS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 27/139 (19%)
Klre1XP_006506184.1 CLECT_NK_receptors_like 139..252 CDD:153063 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.