DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec1a

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_780735.2 Gene:Clec1a / 243653 MGIID:2444151 Length:269 Species:Mus musculus


Alignment Length:219 Identity:51/219 - (23%)
Similarity:83/219 - (37%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 YNRKRLREEQ--EEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNI-FHRDPSE 217
            |....::::.  |::|:..:..|..|.|..|   :..:.|:||.|..:...:.|... .||    
Mouse    75 YQLSNIQQDSITEKDEKLGNMSRQLQSLQAQ---NRKLIETLQQVAVKLCRELYNKSGGHR---- 132

  Fly   218 NEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFK--ANWFKATQYCRYHGMHLASISSQ 280
                  |..|       |.||..    .|:|.|.   |:|  .||.....:|......:..||:|
Mouse   133 ------CSPC-------PEKWKW----YGDKCYQ---FYKESKNWQSCEYFCLADNATMLKISTQ 177

  Fly   281 EENDRLEKHIRDFGLGH---EHFWISGTDLADEGN---FFWMATGRPITFTNWN-AGEPNNFRYE 338
            ||        .||.:..   |.|:...|.|:..|:   :.| ..|.|.:|..:. ..:|.|.|  
Mouse   178 EE--------LDFAMPQSYSEFFYSYWTGLSRNGSGKAWLW-TDGTPYSFELFEIIIDPTNLR-- 231

  Fly   339 NGEEENCLELWN-----RDGKGLK 357
               ..:|:.::|     :|.|.|:
Mouse   232 ---NRDCMTIFNGKAYSKDCKELR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 30/123 (24%)
Clec1aNP_780735.2 CLECT_NK_receptors_like 136..258 CDD:153063 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.