DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Asgr1

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_036635.1 Gene:Asgr1 / 24210 RGDID:2160 Length:284 Species:Rattus norvegicus


Alignment Length:117 Identity:35/117 - (29%)
Similarity:56/117 - (47%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 WFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPIT 323
            |.:|.:||:....||..::|.||...:::|     :|..:.||..||  ..|.:.|: .|.....
  Rat   174 WTEADKYCQLENAHLVVVTSWEEQRFVQQH-----MGPLNTWIGLTD--QNGPWKWVDGTDYETG 231

  Fly   324 FTNWNAGEPNN-FRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
            |.||..|:|:: :.:..|..|:|.. :..||   .|||..|.....:|||.:
  Rat   232 FKNWRPGQPDDWYGHGLGGGEDCAH-FTTDG---HWNDDVCRRPYRWVCETE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/114 (30%)
Asgr1NP_036635.1 Lectin_N 4..143 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 153..278 CDD:153060 34/114 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.