DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and FCER2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001207429.1 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:255 Identity:63/255 - (24%)
Similarity:105/255 - (41%) Gaps:53/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AQRNRLAAAASKRQSGYNRKRLREEQEE---EEEADDQERDQQPLANQE-DFDYD---VQESLQS 197
            |.||  .:..||....::..::.::.:.   .:|.::...:||.|.:|: :..::   :|..|.|
Human    60 AARN--VSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSS 122

  Fly   198 VESEQHDQ--YYGNIFHR------------DPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEK 248
            .:|::.::  ...::..|            ..|...|.|.|          |.||    :....|
Human   123 FKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTC----------PEKW----INFQRK 173

  Fly   249 RYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNF 313
            .||.|...| .|..|...|......|.||.|.||.|.|.||     ..|...||...:|..:|.|
Human   174 CYYFGKGTK-QWVHARYACDDMEGQLVSIHSPEEQDFLTKH-----ASHTGSWIGLRNLDLKGEF 232

  Fly   314 FWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFET-YFVCE 372
            .|: .|..:.::||..|||.:    ..:.|:|:.:   .|.| :|||:.|..:. .:||:
Human   233 IWV-DGSHVDYSNWAPGEPTS----RSQGEDCVMM---RGSG-RWNDAFCDRKLGAWVCD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 40/125 (32%)
FCER2NP_001207429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85 2/18 (11%)
Repetitive region 69..89 1/19 (5%)
RILP-like <77..153 CDD:304877 10/75 (13%)
Repetitive region 90..110 5/19 (26%)
Repetitive region 111..131 4/19 (21%)
CLECT 163..282 CDD:214480 43/147 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.