DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Mgl2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006532975.1 Gene:Mgl2 / 216864 MGIID:2385729 Length:381 Species:Mus musculus


Alignment Length:313 Identity:69/313 - (22%)
Similarity:114/313 - (36%) Gaps:97/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GAQRNRLAAAASKRQSGYNR--------KRLREEQEEEEEADDQERDQQPL-ANQEDFDYDVQ-- 192
            |:|.::|     :|..|..|        |...|.|..:..||:.|:....| .:.||...::|  
Mouse    72 GSQNSQL-----RRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAG 131

  Fly   193 ----ESLQSVES--EQHDQYYGNIFHRDPSE-----NEVDND-----C-----PNCVDESQYTPN 236
                :.:.|:||  |:.:|    ....|.|:     .:::.|     |     .|...|....|.
Mouse   132 RDLSQKVTSLESTLEKREQ----ALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPL 192

  Fly   237 KWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRD----FGLGH 297
            .||.     .|...|.....:.:|.:|.:|||....||..::|.||.:.|:..:.:    .||..
Mouse   193 HWTE-----HEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTD 252

  Fly   298 EH---FWISGTDL---------------------------------ADEGNF----FWMATGRPI 322
            ::   .|:.|||.                                 ...||.    .|.|  :..
Mouse   253 QNGPWRWVDGTDFDKGFKYVCRLQLAPLYLGLSYLFSIFSDPRDLGGPSGNMADGQIWSA--QFF 315

  Fly   323 TFTNWNAGEPNNFR-YENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
            .|.||...:|:|:. :..|..|:|.. ::.||   :|||..|....:::||.:
Mouse   316 IFRNWRPLQPDNWHGHMLGGGEDCAH-FSYDG---RWNDDVCQRHYHWICETE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/168 (22%)
Mgl2XP_006532975.1 Lectin_N 39..180 CDD:367741 25/116 (22%)
CLECT_DC-SIGN_like 190..363 CDD:153060 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.