DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Sftpa1

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_075623.2 Gene:Sftpa1 / 20387 MGIID:109518 Length:248 Species:Mus musculus


Alignment Length:135 Identity:34/135 - (25%)
Similarity:63/135 - (46%) Gaps:22/135 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LLKLGEKRYYLGIFF----KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWI 302
            :|.:|:|     :|.    ..|:....:.|...|.|:|:..:.|||:.:....:.:   :.:.::
Mouse   131 MLSVGDK-----VFSTNGQSVNFDTIREMCTRAGGHIAAPRNPEENEAIASITKKY---NTYPYL 187

  Fly   303 SGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFET 367
            ...:....|:|.:: .|..:.:|||..|||..    .|:|: |:|::. ||   ||||..|....
Mouse   188 GVIEGQTPGDFHYL-DGASVNYTNWYPGEPRG----RGKEK-CVEMYT-DG---KWNDKGCLQYR 242

  Fly   368 YFVCE 372
            ..:||
Mouse   243 LAICE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/128 (24%)
Sftpa1NP_075623.2 Collagen 27..100 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..100
CLECT_collectin_like 136..248 CDD:153061 32/130 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.