DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec11a

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_033157.1 Gene:Clec11a / 20256 MGIID:1298219 Length:328 Species:Mus musculus


Alignment Length:360 Identity:74/360 - (20%)
Similarity:119/360 - (33%) Gaps:105/360 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GNGRDKRGAQLDPSEIARQNQITQQIFANYLERRLFPNRTAN----------------------- 101
            |.||:..|......|..|:.:  .|:..|..|....|....|                       
Mouse    24 GPGREWEGGWGGALEEERERE--SQMLKNLQEALGLPTGVGNEDNLAENPEDKEVWETTETQGEE 86

  Fly   102 --QKIPTIADILPKPKPSPRPRPRGFAASDGGNFKRSGGGAQRNRLAAAASKRQSGYNRKRLREE 164
              ::|.|.....|.|.|||.|.|........|            |||:..:.....:.|..:.:.
Mouse    87 EEEEITTAPSSSPNPFPSPSPTPEDTVTYILG------------RLASLDAGLHQLHVRLHVLDT 139

  Fly   165 QEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQH--DQYYGNIFHRDPSENEVDNDCPNC 227
            :..|.        .|.|....|...|.::|:|:::..|.  :|.:|.:              ..|
Mouse   140 RVVEL--------TQGLRQLRDAASDTRDSVQALKEVQDRAEQEHGRL--------------EGC 182

  Fly   228 VDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRD 292
            :..            |:||.|.:.|...|:.. ..|...|:..|..||..:.:::.|.|.:::| 
Mouse   183 LKG------------LRLGHKCFLLSRDFETQ-AAAQARCKARGGSLAQPADRQQMDALSRYLR- 233

  Fly   293 FGLGHEHF--WISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEE------------- 342
            ..|...::  |:...|...|| .:....|:.::|..|:..    |..|:|.:             
Mouse   234 AALAPYNWPVWLGVHDRRSEG-LYLFENGQRVSFFAWHRA----FSLESGAQPSAATHPLSPDQP 293

  Fly   343 -----ENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
                 |||:...:.||   .|.|..|....|||||
Mouse   294 NGGVLENCVAQASDDG---SWWDHDCERRLYFVCE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/144 (24%)
Clec11aNP_033157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..111 20/88 (23%)
CLECT 182..326 CDD:295302 39/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.