Sequence 1: | NP_612091.1 | Gene: | tfc / 38141 | FlyBaseID: | FBgn0035199 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507868.2 | Gene: | clec-260 / 190430 | WormBaseID: | WBGene00013357 | Length: | 242 | Species: | Caenorhabditis elegans |
Alignment Length: | 269 | Identity: | 52/269 - (19%) |
---|---|---|---|
Similarity: | 70/269 - (26%) | Gaps: | 112/269 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 GRDKRGAQLDPSEIA--RQNQITQQIFANYLERRLFPNRTANQKIPTIADILPKPKPSPR----- 119
Fly 120 ----PR----PRGFAASDG-----------------------GNFKRSGGGAQRNRLAAAASKRQ 153
Fly 154 SGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSEN 218
Fly 219 EV-------DNDCP---NCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANW---FKATQYCRYH 270
Fly 271 GMHLASISS 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tfc | NP_612091.1 | CLECT | 249..373 | CDD:153057 | 8/34 (24%) |
clec-260 | NP_507868.2 | CLECT | 96..239 | CDD:153057 | 31/164 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |