DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-260

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_507868.2 Gene:clec-260 / 190430 WormBaseID:WBGene00013357 Length:242 Species:Caenorhabditis elegans


Alignment Length:269 Identity:52/269 - (19%)
Similarity:70/269 - (26%) Gaps:112/269 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GRDKRGAQLDPSEIA--RQNQITQQIFANYLERRLFPNRTANQKIPTIADILPKPKPSPR----- 119
            ||..|..|.:...:|  :..|...:|.|...:|....||.|.           .|..|||     
 Worm     2 GRPTRQKQSNIRNLANWKAAQAEARILAEEQQRGSTQNRRAT-----------LPAASPRQLNGR 55

  Fly   120 ----PR----PRGFAASDG-----------------------GNFKRSGGGAQRNRLAAAASKRQ 153
                ||    ||...|:..                       ||.|..|..|    ...|...:.
 Worm    56 LTNGPRRSSTPRSSIATSSQAVKRKLRSLANIIYFSFLLAFFGNNKHDGAEA----ACQAQGAKL 116

  Fly   154 SGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSEN 218
            ||:            :..|:..|              ....|::|           |....|..|
 Worm   117 SGF------------QTTDESMR--------------ATHLLRAV-----------INQASPGAN 144

  Fly   219 EV-------DNDCP---NCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANW---FKATQYCRYH 270
            .|       ...||   :|...:.|   :||.     |......|..|..|.   ....|:|...
 Worm   145 TVAWLGGIRKASCPTVQSCTPANSY---QWTD-----GHTTGTAGFTFGVNQPDILGGVQFCLTQ 201

  Fly   271 GMHLASISS 279
            .:| |.:.|
 Worm   202 NVH-AKVDS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 8/34 (24%)
clec-260NP_507868.2 CLECT 96..239 CDD:153057 31/164 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.