DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-118

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_493771.3 Gene:clec-118 / 189207 WormBaseID:WBGene00021032 Length:193 Species:Caenorhabditis elegans


Alignment Length:142 Identity:34/142 - (23%)
Similarity:61/142 - (42%) Gaps:36/142 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 CPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEE-NDRLE 287
            ||...::.:.....|.:.|        ::|::.:.|..:|:..|...|..|:.:.::.| |..:.
 Worm    43 CPTDWEKFERPSGPWCVKL--------FVGLYLQGNRNEASARCATEGAVLSGVQNKAELNAMIS 99

  Fly   288 KHIRDFGLGHEHFWISG---------------TDLADEGNFFWMATGRPITFTN---WNAGEPNN 334
            :..|   ||:.:||:..               |.|   .:|.|  |....|.|:   |.||:|||
 Worm   100 QFTR---LGNGYFWVGAMRKTSCLMSQLTATCTAL---NSFEW--TDGSTTGTDGFIWKAGDPNN 156

  Fly   335 FRYENGEEENCL 346
            ::| |..:|.|:
 Worm   157 YQY-NLYDEPCV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 30/117 (26%)
clec-118NP_493771.3 CLECT 57..191 CDD:153057 32/128 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.