DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-7

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_504865.1 Gene:clec-7 / 184314 WormBaseID:WBGene00017364 Length:417 Species:Caenorhabditis elegans


Alignment Length:177 Identity:37/177 - (20%)
Similarity:63/177 - (35%) Gaps:44/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 IFHRDPSENEVDNDCPNCVDESQYTPNK----WTMPLLKLGEKRYYLGIFFKANWFKATQYCRYH 270
            :|:...|.:...:..|.|.:|.....||    :|.|                ||...|.:.||.:
 Worm     8 LFYFFNSYSVTSSKVPVCTNEFTLINNKCLKLFTTP----------------ANHSAAEKTCRKY 56

  Fly   271 GMHLASISSQEENDRLEKHIRDFGLGHEHFWIS----GTD----LADEGNFFWMATGRPITFTNW 327
            |..|.::.::.:|..:....   |......||.    |.|    |.|:      :||....:.|:
 Worm    57 GATLVTVKNENDNHAISTFA---GTSASLLWIGLYCFGNDPSKCLWDD------STGSADVYDNF 112

  Fly   328 NAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFET-YFVCEV 373
            .:|.|   ..:.|:   |:....:.....||....|...: .|:||:
 Worm   113 ASGFP---LVDIGK---CVYYSVQGALTGKWLTENCDLSSKAFMCEL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 27/132 (20%)
clec-7NP_504865.1 CLECT 25..152 CDD:214480 32/157 (20%)
CLECT 165..282 CDD:214480
CUB 308..412 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.