DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-151

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_497944.2 Gene:clec-151 / 184310 WormBaseID:WBGene00008659 Length:591 Species:Caenorhabditis elegans


Alignment Length:417 Identity:68/417 - (16%)
Similarity:130/417 - (31%) Gaps:160/417 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ISSSSNISRSGGGNGRDKRGAQLDPSEIARQNQITQQIFANYLERRLFPNRTANQKIPTIADILP 112
            ::|.|...|:.....|::.    ||  :|..|..|:      |.:.:|....|...:|| .:.:.
 Worm   235 VTSESAYMRTTSSRIRNEE----DP--LADHNYCTE------LMKPVFRGGEAQSALPT-QEFVK 286

  Fly   113 KPKPSPRPRPRGFAASDGGNFKRSGGGAQRNRLAAAASKRQSG-------------YNRKRLREE 164
            |...:                    |.|:..|.::.:.....|             |:|..::.:
 Worm   287 KLTET--------------------GAAEIIRTSSVSMNANKGERTIVDCVSHVDPYHRVHVKGD 331

  Fly   165 QEEEEEADDQE---RDQQPLANQEDFD-----------YDVQESLQSVESEQHDQYYGNIFHRDP 215
            :.||......:   |.|:|   .|..|           .|....|:::...::...|        
 Worm   332 KNEETSITLNKTIWRQQEP---HETCDAATWSSAAVLSRDSNRGLEAMSDARYAPLY-------- 385

  Fly   216 SENEVDNDCPNCVDESQYT--PNKWT-MPLLKLGEK---RYYLGIFFKANWFKATQYCRYHGMHL 274
                    |.|.::...|:  |..:: .|.:..|::   :|..|.  ...:..|.:.|...|.||
 Worm   386 --------CENILEYFSYSKCPEGFSEFPRVTSGQRWCHKYVHGA--PLPYDDAEKKCAEMGAHL 440

  Fly   275 ASISSQEE----NDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGR----PITFTNWNAGE 331
            :..::|||    |:.:.|.           :.:..|:.     .|:...|    |....|:|.|.
 Worm   441 SGFTTQEEFKFLNELVNKE-----------YPNKNDIE-----VWLGAQRKMSCPDAGKNFNGGF 489

  Fly   332 PNN----------FRYENG--------------------------EEENCL--------ELWN-- 350
            ..|          |.:.||                          ::|.|:        :.|.  
 Worm   490 STNEFDNCARSRVFEWRNGVAKNPPDFIGSGYDNWAELDEPNHLSDKERCVVMMHGKITKYWGYS 554

  Fly   351 ---RDGKGLKWNDSPCSFETYFVCEVQ 374
               .|.:.::.||..|.:...:.|.::
 Worm   555 SKYHDRRDMQINDIFCDWHFEYFCGLE 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/180 (17%)
clec-151NP_497944.2 CLECT 98..>129 CDD:382969
CLECT 398..578 CDD:214480 33/197 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.