DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-86

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_509202.1 Gene:clec-86 / 183775 WormBaseID:WBGene00016912 Length:166 Species:Caenorhabditis elegans


Alignment Length:167 Identity:37/167 - (22%)
Similarity:61/167 - (36%) Gaps:52/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 PNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGM--------------HLA 275
            |||:.                |:..:.:..|         .|.|.||.              .|.
 Worm    18 PNCLP----------------GDTPFEIYCF---------SYNRVHGTFNDSDAHCLKTVGGSLV 57

  Fly   276 SISSQEENDRLEK-HIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYEN 339
            ||.|..||:.::| .:.:....::.|||.|:|.....::.| ..|..:.|||...|:|.      
 Worm    58 SIHSMIENNWIQKLAVDNLDADYDLFWIGGSDEGHTNDWRW-TDGSVLNFTNPGPGQPL------ 115

  Fly   340 GEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQPN 376
             |:.:|..:....|   :|....|:.:..|:|: .||
 Worm   116 -EDRHCGAMQLSTG---RWFSDLCTVKHQFLCQ-YPN 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/138 (22%)
clec-86NP_509202.1 CLECT 20..144 CDD:214480 32/159 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.