DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-185

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_502375.4 Gene:clec-185 / 182914 WormBaseID:WBGene00007729 Length:504 Species:Caenorhabditis elegans


Alignment Length:85 Identity:20/85 - (23%)
Similarity:35/85 - (41%) Gaps:23/85 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CRYHGMHLASISSQEENDRLEKHIRDFGLGHE---HFWISGTDLADEGNFFWMATGRPITFTNWN 328
            |.:....:.::||:|||..:.   |.||...|   ..||..|:          ::|    :.||:
 Worm   411 CTWCNGTMVTVSSKEENSFVS---RVFGSNDETTRQIWIGNTE----------SSG----YLNWS 458

  Fly   329 AGEPNNFRYENGEEENCLEL 348
            .|:|..   .|...:.|:.:
 Worm   459 PGQPTK---PNDGLDYCISM 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 20/85 (24%)
clec-185NP_502375.4 CLECT 84..217 CDD:214480
CLECT 391..500 CDD:214480 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.