DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-49

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_507829.1 Gene:clec-49 / 180298 WormBaseID:WBGene00012251 Length:321 Species:Caenorhabditis elegans


Alignment Length:111 Identity:31/111 - (27%)
Similarity:48/111 - (43%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 ATQYCRYHGMHLASISSQEENDRLEKHIRDF--GLGHEHFWISGTDLADEGNFFWMATGRPITFT 325
            |.|.|...|.||||:.:.:||..|:.:..:.  ...:..:||..|||...|.:.|........::
 Worm    46 AEQQCNLLGGHLASVQNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYS 110

  Fly   326 NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 371
            ||..|||     ::|.:  |......||   .|:...|:....:||
 Worm   111 NWQLGEP-----QSGSD--CAIQDKGDG---TWSAIGCTSYRPYVC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/111 (28%)
clec-49NP_507829.1 CLECT 31..146 CDD:214480 29/109 (27%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.