DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-178

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_500843.1 Gene:clec-178 / 177344 WormBaseID:WBGene00020585 Length:178 Species:Caenorhabditis elegans


Alignment Length:136 Identity:33/136 - (24%)
Similarity:55/136 - (40%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 KLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEEN---DRLEKHIRDFGLGHEHFWISGT 305
            :|.|..:|........|..|...||..|.||.||..:.||   .:|.|        ..:.||...
 Worm    55 QLYEDHWYKMFETDVMWIPAENVCRSMGGHLVSIKDESENLFVHKLRK--------KNNIWIGLN 111

  Fly   306 DLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLEL-WNRDGKGLKWNDSPC--SFET 367
            .|.|..:.:..:.|....:.||.:.:||.      .:.:|..: ::::.:| .|.|..|  ....
 Worm   112 KLNDTFHVYKWSDGSEADYLNWASSQPNE------PDVDCAYMAFHQEQRG-TWFDYGCREMLPQ 169

  Fly   368 YFVCEV 373
            :|||::
 Worm   170 FFVCKL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/129 (24%)
clec-178NP_500843.1 CLECT 52..174 CDD:214480 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.