DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Clec4d

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_034949.3 Gene:Clec4d / 17474 MGIID:1298389 Length:219 Species:Mus musculus


Alignment Length:161 Identity:42/161 - (26%)
Similarity:67/161 - (41%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 CVDESQY---TPNKWTMPLLKLGEKRYYLGIFFKAN----WFKATQYCRYHGMHLASISSQEEND 284
            |:.|...   |...||  ...:..:.:....:|..|    |.::.:.|.....||.:|:::.|.:
Mouse    66 CIREEPQPGATGGTWT--CCPVSWRAFQSNCYFPLNDNQTWHESERNCSGMSSHLVTINTEAEQN 128

  Fly   285 ----RLEKHIRDF-GLGHEHFWISGTDLADEGNFFWM--ATGRPITFTNWNAGEPNNFRYENGEE 342
                .|:|....| ||..|:.         ||.:.|:  ....|.| ..|..||.|:|.     |
Mouse   129 FVTQLLDKRFSYFLGLADENV---------EGQWQWVDKTPFNPHT-VFWEKGESNDFM-----E 178

  Fly   343 ENCLELWNRDGKGLKWNDSPCSFETYFVCEV 373
            |:|:.|.:...|.: |||.||.||...:|::
Mouse   179 EDCVVLVHVHEKWV-WNDFPCHFEVRRICKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/134 (28%)
Clec4dNP_034949.3 CLECT_DC-SIGN_like 83..207 CDD:153060 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.