powered by:
Protein Alignment tfc and clec-117
DIOPT Version :9
Sequence 1: | NP_612091.1 |
Gene: | tfc / 38141 |
FlyBaseID: | FBgn0035199 |
Length: | 376 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493698.1 |
Gene: | clec-117 / 173417 |
WormBaseID: | WBGene00015193 |
Length: | 185 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 33/57 - (57%) |
Gaps: | 4/57 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 248 KRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISG 304
|.|:| |.|:.:|.::|..:|.|||.|:|:||..:|.....:.|..:|.:|:.|
Worm 36 KLYHL----KMNFPRAKKHCEQNGAHLAGITSREEAQKLIDLANEAGESNEQYWLGG 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tfc | NP_612091.1 |
CLECT |
249..373 |
CDD:153057 |
19/56 (34%) |
clec-117 | NP_493698.1 |
CLECT |
35..179 |
CDD:153057 |
20/57 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.