DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec-87

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_492682.1 Gene:clec-87 / 172885 WormBaseID:WBGene00007709 Length:233 Species:Caenorhabditis elegans


Alignment Length:253 Identity:45/253 - (17%)
Similarity:75/253 - (29%) Gaps:108/253 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 EEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRD---PSENEVDNDCPNC 227
            |..|.:...:.|:||......:::|.::             .|.....|   |:...     |..
 Worm    33 EAPETSPLVQNDEQPHQRLTFYNWDYKD-------------LGTTAFEDISFPARQP-----PAF 79

  Fly   228 VDESQYTPNKWTMPLLKLGEKRYY-----LGIFFKANWFKATQYCRYHGMHLASISSQEENDRLE 287
            |::::..|:.|    |:..:..|:     ||      :.||.:.|......|...:|.||.|.:.
 Worm    80 VNQTEKCPDGW----LRFADSCYWIEKELLG------FAKAERNCFEKQSTLFVANSIEEWDAIR 134

  Fly   288 KHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRD 352
            ..                  |.|..|.|:..   :.||:          ||..|:   |..|..:
 Worm   135 VQ------------------AKEAFFSWIGL---VRFTH----------YEKLEQ---LPRWQTE 165

  Fly   353 G-----------KGLK-----WND----------------------SPCSFETYFVCE 372
            |           |..|     |:.                      .||::..|.:||
 Worm   166 GALNPTKINWLIKPYKPLFNGWSSLANCAASYKSPSSLESASYTYFYPCTYMLYSICE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/167 (19%)
clec-87NP_492682.1 Lectin_C 107..224 CDD:278488 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.