DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Cd209d

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_570974.1 Gene:Cd209d / 170779 MGIID:2157947 Length:237 Species:Mus musculus


Alignment Length:190 Identity:47/190 - (24%)
Similarity:78/190 - (41%) Gaps:57/190 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLG-- 253
            :.:.|..:::|.||..                 |..|..:       ||          ::.|  
Mouse    87 IYQELMQLKAEVHDGL-----------------CQPCARD-------WT----------FFNGSC 117

  Fly   254 IFF---KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFW 315
            .||   :.||..:|..|:..|..|..|.:.||...|::..:..|    ..|:..:|:.:|..:.|
Mouse   118 YFFSKSQRNWHNSTTACQELGAQLVIIETDEEQTFLQQTSKARG----PTWMGLSDMHNEATWHW 178

  Fly   316 MATGRPI--TFTN-WNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            : .|.|:  :||. ||.|||||.     .:|:|.| ::.||    |||..|....:::|:
Mouse   179 V-DGSPLSPSFTRYWNRGEPNNV-----GDEDCAE-FSGDG----WNDLSCDKLLFWICK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/132 (30%)
Cd209dNP_570974.1 CLECT_DC-SIGN_like 106..228 CDD:153060 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.