DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Cd209c

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_017168078.1 Gene:Cd209c / 170776 MGIID:2157945 Length:240 Species:Mus musculus


Alignment Length:159 Identity:44/159 - (27%)
Similarity:73/159 - (45%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQE 281
            :::::..|..|       |..||     :.:...|....|:.||..:...||.....|..|.|.:
Mouse   100 KSQINRLCRPC-------PWDWT-----VFQGNCYFFSKFQQNWNDSVNACRKLDAQLVVIKSDD 152

  Fly   282 ENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFT---NWNAGEPNNFRYENGEEE 343
            |...|::..::.|    :.|:..:||..||.:.|: .|..:.|:   .||.||||     |..||
Mouse   153 EQSFLQQTSKEKG----YAWMGLSDLKHEGRWHWV-DGSHLLFSFMKYWNKGEPN-----NEWEE 207

  Fly   344 NCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            :|.|.     :|..|||:||:.:.|::|:
Mouse   208 DCAEF-----RGDGWNDAPCTIKKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 39/127 (31%)
Cd209cXP_017168078.1 CLECT_DC-SIGN_like 110..232 CDD:153060 43/149 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840981
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.