DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Klra1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_057868.2 Gene:Klra1 / 16627 MGIID:101907 Length:262 Species:Mus musculus


Alignment Length:189 Identity:33/189 - (17%)
Similarity:59/189 - (31%) Gaps:58/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 FKRSGGGAQRNRLAAAASKRQSGYNR------------------------------------KRL 161
            |.:|.|..::.|.......|::||.|                                    |:|
Mouse    13 FHKSAGLQKQVRPEETKGPREAGYRRCSFHWKFIVIALGIFCFLLLVAVSVLAIKIFQYDQQKKL 77

  Fly   162 REEQEEEEEADDQERD---QQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDND 223
            :|.........:.:.|   :..:...:..:.|:.|||                :||  :|.:.|.
Mouse    78 QEFLNHHNNCSNMQSDINLKDEMLKNKSIECDLLESL----------------NRD--QNRLYNK 124

  Fly   224 CPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEE 282
            ....:|..|:|.....:.....|.|.||. :..:..|....|.|:...:.|..|..::|
Mouse   125 TKTVLDSLQHTGRGDKVYWFCYGMKCYYF-VMDRKTWSGCKQTCQSSSLSLLKIDDEDE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 8/34 (24%)
Klra1NP_057868.2 Ly49 40..153 CDD:285577 18/130 (14%)
Cell attachment site 137..139 0/1 (0%)
CLECT_NK_receptors_like 142..255 CDD:153063 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.