DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CG43797

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001260012.1 Gene:CG43797 / 14462692 FlyBaseID:FBgn0264341 Length:232 Species:Drosophila melanogaster


Alignment Length:202 Identity:46/202 - (22%)
Similarity:81/202 - (40%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 QQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDN------DCPNCVDESQYTPN 236
            |:||........:....:.|:::|.|::.       ...|||:.|      :....::|:..|..
  Fly    48 QRPLFEHNRIIQNQIYEISSLQAESHERL-------KRIENELINLQIEQKESKQAINENDDTKV 105

  Fly   237 KW--TMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEH 299
            :.  |...:.|.:|:.|:.:....||:.|.::|:..|..||..|.:.|.|.:...:..    ...
  Fly   106 EGIETTTSVNLIKKKKYVIVDKALNWYNAVKFCQEIGGKLAEFSDEHEYDTVISTVEP----DTC 166

  Fly   300 FWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCS 364
            :||......:|.... ....||:...  .|..|||..: ||  |||:.:.|    |. .:|..|:
  Fly   167 YWIGIRSYNNEHQSL-RTDNRPLYLK--MADMPNNNIF-NG--ENCVGIQN----GF-MHDLWCN 220

  Fly   365 FETYFVC 371
            ...|.:|
  Fly   221 LSYYSIC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/123 (25%)
CG43797NP_001260012.1 CLECT 122..227 CDD:153057 30/119 (25%)

Return to query results.
Submit another query.