DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Fcer2a

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:333 Identity:85/333 - (25%)
Similarity:125/333 - (37%) Gaps:90/333 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PTIADILPKPKPSPRPRPRGFAASDG-----------------------------GNFKRSGGGA 140
            |:|..:||.....| ||.|...|..|                             .|.|:.|..|
Mouse     3 PSIFSMLPTGYWEP-PRKRCCCARRGTQLMLVGLLSTAMWAGLLALLLLWHWETEKNLKQLGDTA 66

  Fly   141 --------------QRNRLAAAASKRQSGYNRKRLREEQEEEEEADDQERD-----QQPLANQED 186
                          |.|:||..:...|...|.:.|:.||::.:..|.:...     |:.|.|.:.
Mouse    67 IQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQS 131

  Fly   187 FDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDES----------------QYTP 235
            .:..:.::|..::.:     ..||.....:|....:|....:.|.                ...|
Mouse   132 QNSKLSQNLNRLQDD-----LVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICP 191

  Fly   236 NKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHF 300
            ..|    |...:|.||.|...| .|.:|...|......|.||.||:|.|.|.:||     ..:..
Mouse   192 KNW----LHFQQKCYYFGKGSK-QWIQARFACSDLQGRLVSIHSQKEQDFLMQHI-----NKKDS 246

  Fly   301 WISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPC-S 364
            ||...||..||.|.| :.|.|:.::|||.|||||    .|:.|:|:.:   .|.| :|||:.| |
Mouse   247 WIGLQDLNMEGEFVW-SDGSPVGYSNWNPGEPNN----GGQGEDCVMM---RGSG-QWNDAFCRS 302

  Fly   365 FETYFVCE 372
            :...:|||
Mouse   303 YLDAWVCE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 48/125 (38%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056 19/102 (19%)
CLECT_DC-SIGN_like 190..310 CDD:153060 50/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840994
Domainoid 1 1.000 72 1.000 Domainoid score I9266
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5255
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43806
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.