DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Olr1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_579840.2 Gene:Olr1 / 140914 RGDID:620515 Length:368 Species:Rattus norvegicus


Alignment Length:398 Identity:71/398 - (17%)
Similarity:132/398 - (33%) Gaps:146/398 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLIVVLISLASVDSGHNSPVTTIPVAEPISQV-----PHGFQLGQNNHISSSSNISRSGGGNGRD 64
            ||.::.:.|:         ||.|.....:.||     .:...|.|.:||......::....|...
  Rat    44 TLAILCLVLS---------VTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQ 99

  Fly    65 KRGAQL----------------DPSEIARQNQITQQIFANYLERRLFPNRTANQKIPTIADILPK 113
            :...:|                :..::.:|||..|:.    |:|.:..:..:..::....|||  
  Rat   100 ESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEA----LQRAVNASEESKWELKEQIDIL-- 158

  Fly   114 PKPSPRPRPRGFAASDGGNFKRSGGG------AQRNRLAAAASKRQSGYNRKRLREEQEEEE--- 169
                              |:|.:|..      .|:|:....|.::...|:.:..||.:|:.:   
  Rat   159 ------------------NWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLS 205

  Fly   170 -EADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQY 233
             :.:::.::|:.|..|   :.::||:||...:.........|:|::           ||      
  Rat   206 WKLNEKSKEQEELLQQ---NQNLQEALQRAANSSGPCPQDWIWHKE-----------NC------ 250

  Fly   234 TPNKWTMPLLKLGEKRYYL--GIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLG 296
                             ||  |.|   ||.|:.:.|......|..||:.::              
  Rat   251 -----------------YLFHGPF---NWEKSRENCLSLDAQLLQISTTDD-------------- 281

  Fly   297 HEHFWISGTDLADEGNFFWMATGR--PITFTNWNAGEPNNFR-----------YENGE------- 341
             .:|.:..|  :...:.|||...|  |.....|..|.|.:|:           |.:|.       
  Rat   282 -LNFVLQAT--SHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGG 343

  Fly   342 ---EENCL 346
               .|||:
  Rat   344 VVFAENCI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 27/123 (22%)
Olr1NP_579840.2 GBP_C <116..231 CDD:303769 25/141 (18%)
coiled coil 207..218 CDD:293879 1/10 (10%)
CLECT_NK_receptors_like 239..360 CDD:153063 31/167 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.