DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Colec12

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_569716.2 Gene:Colec12 / 140792 MGIID:2152907 Length:742 Species:Mus musculus


Alignment Length:160 Identity:48/160 - (30%)
Similarity:69/160 - (43%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQE 281
            :||     |....|....|..|.    ...:|.||..: .|..:..|..:|.....||..|:|:|
Mouse   595 QNE-----PTPASEVNGCPPHWK----NFTDKCYYFSL-EKEIFEDAKLFCEDKSSHLVFINSRE 649

  Fly   282 ENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCL 346
            |...::||.    :|.|..||..||...|..:.|: .|.|:.:.||.||:|:|:...:|..|:| 
Mouse   650 EQQWIKKHT----VGRESHWIGLTDSEQESEWKWL-DGSPVDYKNWKAGQPDNWGSGHGPGEDC- 708

  Fly   347 ELWNRDGKGL----KWNDSPCSFETYFVCE 372
                   .||    :|||..|.....|:||
Mouse   709 -------AGLIYAGQWNDFQCDEINNFICE 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/128 (32%)
Colec12NP_569716.2 CwlO1 48..280 CDD:226400
VirB5_like 157..317 CDD:295212
Fimbrial <286..359 CDD:294848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..608 4/17 (24%)
Collagen 454..563 CDD:189968
CLECT_DC-SIGN_like 607..732 CDD:153060 44/143 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5255
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.