DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CG43055

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:144 Identity:44/144 - (30%)
Similarity:73/144 - (50%) Gaps:11/144 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 NKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHF 300
            |..|.|.:|:|:..|::......||:.|.:.||.....|.:...::|...:..::.|..: ...:
  Fly    36 NTPTAPFVKIGDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEM-DTTY 99

  Fly   301 WISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE---LWNRDGKGLKWNDSP 362
            |.:|||||::.:|.|.:.|:|:....|...||||.:    .||:|:|   |......||  ||..
  Fly   100 WTAGTDLAEQDSFVWFSNGQPVASDLWCNNEPNNAK----NEEHCVEYKPLHPEAKMGL--NDRV 158

  Fly   363 CSFETYFVCEV-QP 375
            |:|:|.::|.. ||
  Fly   159 CTFKTGYICRAPQP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/126 (29%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 36/124 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.