DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Bcan

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_030108256.1 Gene:Bcan / 12032 MGIID:1096385 Length:900 Species:Mus musculus


Alignment Length:463 Identity:103/463 - (22%)
Similarity:165/463 - (35%) Gaps:136/463 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DSGH-------NSPVT-----TIPVAEPIS--QVPHGFQLGQNNHISSSSNISRSGGGNG---RD 64
            ||.|       :||.:     .:.|.|.:.  |:|......::.....|..||..|||..   .|
Mouse   371 DSAHPSASSEASSPASDGLEAIVTVTEKLEELQLPQEAMESESRGAIYSIPISEDGGGGSSTPED 435

  Fly    65 KRGAQLDPSE-----IARQNQITQQIFANYLERRLFPN-----------------RTANQKIPT- 106
            ...|...|.|     ||...:.:::......|...|.:                 |..:..:|| 
Mouse   436 PAEAPRTPLESETQSIAPPTESSEEEGVALEEEERFKDLEALEEEKEQEDLWVWPRELSSPLPTG 500

  Fly   107 ------IADILP----------KPKPSPRPRPRGFAASD-----GGNFKRSGGGAQRNRLAAAAS 150
                  ::.:.|          .|.|.| ||.||..|..     .|:...:.||| |.......|
Mouse   501 SETEHSLSQVSPPAQAVLQLGASPSPGP-PRVRGPPAETLLPPREGSPTSTPGGA-REVGGETGS 563

  Fly   151 KRQSGYNRKRLREEQEEEEEADDQERDQQPL--------ANQEDFDYDVQE----------SLQS 197
            ...||..|        |.|||.....:..|.        ....:.:...:|          |:|:
Mouse   564 PELSGVPR--------ESEEAGSSSLEDGPSLLPATWAPVGPRELETPSEEKSGRTVLAGTSVQA 620

  Fly   198 -----VESEQHDQYYGNIFHRDPSENEVDNDCPN---CVDESQYTPNKWTMPLLKLGEKRYYLGI 254
                 .:|..|    |.:.....|.:.:.:.|.|   |::|.:   ....:.|...|.....:|:
Mouse   621 QPVLPTDSASH----GGVAVAPSSGDCIPSPCHNGGTCLEEKE---GFRCLCLPGYGGDLCDVGL 678

  Fly   255 FF------------------KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFW 301
            .|                  :.:|.:|...||..|.||.||.:.||.|.:....|      |:.|
Mouse   679 HFCSPGWEAFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYR------EYQW 737

  Fly   302 ISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLEL-WNRDGKGLKWNDSPCSF 365
            |...|...||:|.| :.|.|:.:.|||.|:|::: :.:|  |||:.: |:..|   :|:|.||::
Mouse   738 IGLNDRTIEGDFLW-SDGAPLLYENWNPGQPDSY-FLSG--ENCVVMVWHDQG---QWSDVPCNY 795

  Fly   366 ETYFVCEV 373
            ...:.|::
Mouse   796 HLSYTCKM 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/142 (29%)
BcanXP_030108256.1 Ig 65..174 CDD:386229
Link_domain_CSPGs_modules_1_3 173..267 CDD:239594
Link_domain_CSPGs_modules_2_4 274..369 CDD:239597
Treacle 499..>635 CDD:367557 30/149 (20%)
EGF 643..672 CDD:333761 6/31 (19%)
CLECT 681..804 CDD:382969 39/136 (29%)
CCP 808..865 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9266
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11806
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.