DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and Asgr1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001278060.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:236 Identity:62/236 - (26%)
Similarity:99/236 - (41%) Gaps:54/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AASKRQSGYNRK-RLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIF 211
            |.|.:.|...|| :|.|.:.|:::.|..|.....|.:.:....||: ||    |.|...:.||..
Mouse    89 ALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVR-SL----SCQMAAFRGNGS 148

  Fly   212 HRDPSENEVDNDCP-NCVDESQYTPNKWTMPLLKLGEKRYYLG--IFFKAN---WFKATQYCRYH 270
            .|        ..|| |.|:                     |.|  .:|.::   |.:|.:||:..
Mouse   149 ER--------TCCPINWVE---------------------YEGSCYWFSSSVRPWTEADKYCQLE 184

  Fly   271 GMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNN 334
            ..||..::|::|.:.|::|     :|..:.||..||  ..|.:.|: .|.....|.||...:|:|
Mouse   185 NAHLVVVTSRDEQNFLQRH-----MGPLNTWIGLTD--QNGPWKWVDGTDYETGFQNWRPEQPDN 242

  Fly   335 -FRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQ 374
             :.:..|..|:|.. :..||   :|||..|.....:|||.:
Mouse   243 WYGHGLGGGEDCAH-FTTDG---RWNDDVCRRPYRWVCETK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/130 (28%)
Asgr1NP_001278060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859 17/58 (29%)
CLECT_DC-SIGN_like 153..278 CDD:153060 41/156 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.