DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC110440085

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021335186.1 Gene:LOC110440085 / 110440085 -ID:- Length:348 Species:Danio rerio


Alignment Length:209 Identity:44/209 - (21%)
Similarity:72/209 - (34%) Gaps:69/209 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 SEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKR--------------- 249
            :|:.::....|.:....::::.|...|..:|.....||.|    .|.|:|               
Zfish   166 TEEKNKMLNKITNLTEEKSKMLNKITNLTEEKSKMLNKIT----NLTEERNKILTNITNLTKERD 226

  Fly   250 -----------YYLGIFF-----KANWFKATQYCRYHGMHLASISSQEENDRLEK---------H 289
                       ||...|:     :.:|.::.:||...|..|..:::.||.|.|.|         .
Zfish   227 QLQEKNKDGWFYYQSSFYFISSEEKSWSESRRYCSDRGADLIIVNNSEEQDILNKLSGRIAVWIG 291

  Fly   290 IRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGK 354
            :...|......||.||:         |.||.      |:.||||    |.|.|...:      .:
Zfish   292 LTGSGKNRSWTWIDGTN---------MTTGL------WSHGEPN----EAGGEICAV------SR 331

  Fly   355 GLKWNDSPCSFETY 368
            ..:||.|....:|:
Zfish   332 SSEWNISHSDEKTF 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/160 (21%)
LOC110440085XP_021335186.1 SMC_N <8..>233 CDD:330553 11/70 (16%)
CLECT 234..336 CDD:321932 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D605458at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.