DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC110438236

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021324869.1 Gene:LOC110438236 / 110438236 -ID:- Length:439 Species:Danio rerio


Alignment Length:293 Identity:59/293 - (20%)
Similarity:94/293 - (32%) Gaps:120/293 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LANQEDFDYDVQESLQSVESEQHDQYYGNI----FHR----------------------DPSENE 219
            ||..|.|  .:..:|.:::||: :|::.|.    ||:                      |.:..|
Zfish    59 LAQTECF--SMGANLLTIKSEE-EQFFINAQLPDFHQVDIPDLWIGVSDKDQDGTFRWVDKTAIE 120

  Fly   220 VDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLG------------------------------- 253
            ..|..||.   .|.||.:|....:..|.   |.|                               
Zfish   121 FSNWSPNF---PQDTPKQWDCGQIYTGN---YAGKWESTNCFKNLGYICKMAGGQNVKPTPAPDS 179

  Fly   254 ------IFFK-----------ANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGH---- 297
                  :.|:           .||..|..||.....||.|:..||....|.      |..|    
Zfish   180 HCDEGYLLFQDHCFHFESESVKNWQDAESYCVAQNGHLVSVHDQETISFLT------GAAHLGYP 238

  Fly   298 -----------------EHFWISGTDLADEGNFFWMATGRPI--TFTNWNAGEPNNFRYENGEEE 343
                             ..:||...|:|.|||:.| :.|...  ..:.|..|:|:|:    .:.|
Zfish   239 LHWVKKQSTWVRTQISSSIYWIGLNDIASEGNWEW-SDGSVFYPYLSYWKEGQPDNW----ADNE 298

  Fly   344 NCLELWNRDGKGLKWNDSPCSFETYFVCEVQPN 376
            :|.::  :.....:|||..|:....::|: :||
Zfish   299 DCGQV--QGASNGQWNDETCTSRRQYICK-RPN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/194 (19%)
LOC110438236XP_021324869.1 CLECT 33..164 CDD:214480 23/113 (20%)
CLECT 181..326 CDD:321932 34/158 (22%)
CLECT 339..>439 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.